SCOPe 2.07: Domain d3zt4b_: 3zt4 B:

Lineage for d3zt4b_ (3zt4 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries)

8. Domain d3zt4b_: 3zt4 B: [218457]
   automated match to d3zcmb_
   complexed with acy, edo, so4, zt2

Details for d3zt4b_

PDB Entry: 3zt4, 2.2 Å

PDB Description: Small molecule inhibitors of the LEDGF site of HIV type 1 integrase identified by fragment screening and structure based drug design

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3zt4b_:

Sequence, based on SEQRES records:

>d3zt4b_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d3zt4b_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkgysagerivdiiatdiq

Timeline for d3zt4b_:

• d3zt4b_ first appeared in SCOPe 2.03
  
• d3zt4b_ appears in SCOPe 2.06
  
• d3zt4b_ appears in the current release, SCOPe 2.08