Lineage for d1qhpa1 (1qhp A:496-576)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9616Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 9655Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49218] (2 PDB entries)
  8. 9657Domain d1qhpa1: 1qhp A:496-576 [21845]
    Other proteins in same PDB: d1qhpa2, d1qhpa3, d1qhpa4

Details for d1qhpa1

PDB Entry: 1qhp (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex

SCOP Domain Sequences for d1qhpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhpa1 b.1.1.5 (A:496-576) Cyclodextrin glycosyltransferase, domain E {Bacillus stearothermophilus, maltogenic alpha-amylase}
asapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvkswtsnrievyvpnmaa
gltdvkvtaggvssnlysyni

SCOP Domain Coordinates for d1qhpa1:

Click to download the PDB-style file with coordinates for d1qhpa1.
(The format of our PDB-style files is described here.)

Timeline for d1qhpa1: