Lineage for d1qhpa1 (1qhp A:496-576)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49218] (2 PDB entries) 
Domain d1qhpa1: 1qhp A:496-576 [21845]
Other proteins in same PDB: d1qhpa2, d1qhpa3, d1qhpa4
Details for d1qhpa1
PDB Entry: 1qhp (more details), 1.7 Å
PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex
SCOP Domain Sequences for d1qhpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhpa1 b.1.1.5 (A:496-576) Cyclodextrin glycosyltransferase, domain E {Bacillus stearothermophilus, maltogenic alpha-amylase}
asapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvkswtsnrievyvpnmaa
gltdvkvtaggvssnlysyni
SCOP Domain Coordinates for d1qhpa1:
Click to download the PDB-style file with coordinates for d1qhpa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qhpa1:
- d1qhpa1 appears in SCOP 1.57
- d1qhpa1 appears in the current release, SCOPe 2.08
View in 3D
