SCOPe 2.06: Domain d3zsxb_: 3zsx B:

Lineage for d3zsxb_ (3zsx B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries)

8. Domain d3zsxb_: 3zsx B: [218443]
   automated match to d3zcmb_
   complexed with act, edo, gol, n44, so4

Details for d3zsxb_

PDB Entry: 3zsx, 1.95 Å

PDB Description: Small molecule inhibitors of the LEDGF site of HIV type 1 integrase identified by fragment screening and structure based drug design

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3zsxb_:

Sequence, based on SEQRES records:

>d3zsxb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d3zsxb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

Timeline for d3zsxb_:

• d3zsxb_ first appeared in SCOPe 2.03
  
• d3zsxb_ appears in SCOPe 2.05
  
• d3zsxb_ appears in SCOPe 2.07
  
• d3zsxb_ appears in the current release, SCOPe 2.08