SCOPe 2.04: Domain d3zswb_: 3zsw B:

Lineage for d3zswb_ (3zsw B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (7 species)
   not a true protein

7. Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries)

8. Domain d3zswb_: 3zsw B: [218441]
   automated match to d3zcmb_
   complexed with acy, cl, gol, so4, thr, zsw

Details for d3zswb_

PDB Entry: 3zsw, 1.8 Å

PDB Description: small molecule inhibitors of the ledgf site of hiv type 1 integrase identified by fragment screening and structure based drug design

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3zswb_:

Sequence, based on SEQRES records:

>d3zswb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d3zswb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

Timeline for d3zswb_:

• d3zswb_ first appeared in SCOPe 2.03
  
• d3zswb_ appears in SCOPe 2.05
  
• d3zswb_ appears in the current release, SCOPe 2.08