![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D [81280] (1 species) domain architecture similar to cyclomaltodextrin glycosylhydrolases |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81281] (2 PDB entries) |
![]() | Domain d1qhoa1: 1qho A:496-576 [21844] Other proteins in same PDB: d1qhoa2, d1qhoa3, d1qhoa4 complexed with abd, ca, mal, so4 |
PDB Entry: 1qho (more details), 1.7 Å
SCOPe Domain Sequences for d1qhoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} asapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvkswtsnrievyvpnmaa gltdvkvtaggvssnlysyni
Timeline for d1qhoa1: