Lineage for d1qhoa1 (1qho A:496-576)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54548Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 54589Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [49218] (2 PDB entries)
  8. 54590Domain d1qhoa1: 1qho A:496-576 [21844]
    Other proteins in same PDB: d1qhoa2, d1qhoa3, d1qhoa4

Details for d1qhoa1

PDB Entry: 1qho (more details), 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose/acarbose complex

SCOP Domain Sequences for d1qhoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhoa1 b.1.1.5 (A:496-576) Cyclodextrin glycosyltransferase, domain E {Bacillus stearothermophilus, maltogenic alpha-amylase}
asapqigsvapnmgipgnvvtidgkgfgttqgtvtfggvtatvkswtsnrievyvpnmaa
gltdvkvtaggvssnlysyni

SCOP Domain Coordinates for d1qhoa1:

Click to download the PDB-style file with coordinates for d1qhoa1.
(The format of our PDB-style files is described here.)

Timeline for d1qhoa1: