Lineage for d3zsra_ (3zsr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886283Protein automated matches [190209] (5 species)
    not a true protein
  7. 2886418Species Human immunodeficiency virus [TaxId:12721] [193331] (20 PDB entries)
  8. 2886421Domain d3zsra_: 3zsr A: [218436]
    automated match to d3zcmb_
    complexed with cl, gol, o3n, so4

Details for d3zsra_

PDB Entry: 3zsr (more details), 1.7 Å

PDB Description: Small molecule inhibitors of the LEDGF site of HIV type 1 integrase identified by fragment screening and structure based drug design
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d3zsra_:

Sequence, based on SEQRES records: (download)

>d3zsra_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d3zsra_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus [TaxId: 12721]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq

SCOPe Domain Coordinates for d3zsra_:

Click to download the PDB-style file with coordinates for d3zsra_.
(The format of our PDB-style files is described here.)

Timeline for d3zsra_: