Class a: All alpha proteins [46456] (285 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (40 species) not a true protein |
Species Micromonospora griseorubida [TaxId:28040] [226290] (8 PDB entries) |
Domain d3zsnb_: 3zsn B: [218430] automated match to d3e5la_ complexed with ben, gol, hem, miv; mutant |
PDB Entry: 3zsn (more details), 1.9 Å
SCOPe Domain Sequences for d3zsnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zsnb_ a.104.1.0 (B:) automated matches {Micromonospora griseorubida [TaxId: 28040]} epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtaapryavedvtlrgvtirag epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll qrlpgirlgipetqlrwsegmllrgplelpvvw
Timeline for d3zsnb_: