Lineage for d1cyga1 (1cyg A:492-574)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375146Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2375192Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 2375251Species Bacillus stearothermophilus [TaxId:1422] [49217] (1 PDB entry)
  8. 2375252Domain d1cyga1: 1cyg A:492-574 [21843]
    Other proteins in same PDB: d1cyga2, d1cyga3, d1cyga4
    complexed with ca

Details for d1cyga1

PDB Entry: 1cyg (more details), 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1cyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]}
estpiighvgpmmgqvghqvtidgegfgtntgtvkfgttaanvvswsnnqivvavpnvsp
gkynitvqsssgqtsaaydnfev

SCOPe Domain Coordinates for d1cyga1:

Click to download the PDB-style file with coordinates for d1cyga1.
(The format of our PDB-style files is described here.)

Timeline for d1cyga1: