![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [49217] (1 PDB entry) |
![]() | Domain d1cyg_1: 1cyg 492-574 [21843] Other proteins in same PDB: d1cyg_2, d1cyg_3, d1cyg_4 complexed with ca |
PDB Entry: 1cyg (more details), 2.5 Å
SCOP Domain Sequences for d1cyg_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyg_1 b.1.18.2 (492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus} estpiighvgpmmgqvghqvtidgegfgtntgtvkfgttaanvvswsnnqivvavpnvsp gkynitvqsssgqtsaaydnfev
Timeline for d1cyg_1: