Lineage for d1cyg_1 (1cyg 492-574)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223333Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 223374Species Bacillus stearothermophilus [TaxId:1422] [49217] (1 PDB entry)
  8. 223375Domain d1cyg_1: 1cyg 492-574 [21843]
    Other proteins in same PDB: d1cyg_2, d1cyg_3, d1cyg_4
    complexed with ca

Details for d1cyg_1

PDB Entry: 1cyg (more details), 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

SCOP Domain Sequences for d1cyg_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyg_1 b.1.18.2 (492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus}
estpiighvgpmmgqvghqvtidgegfgtntgtvkfgttaanvvswsnnqivvavpnvsp
gkynitvqsssgqtsaaydnfev

SCOP Domain Coordinates for d1cyg_1:

Click to download the PDB-style file with coordinates for d1cyg_1.
(The format of our PDB-style files is described here.)

Timeline for d1cyg_1: