Lineage for d3zsna_ (3zsn A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278119Species Micromonospora griseorubida [TaxId:28040] [226290] (8 PDB entries)
  8. 1278127Domain d3zsna_: 3zsn A: [218429]
    automated match to d3e5la_
    complexed with ben, gol, hem, miv; mutant

Details for d3zsna_

PDB Entry: 3zsn (more details), 1.9 Å

PDB Description: Structure of the mixed-function P450 MycG F286A mutant in complex with mycinamicin IV
PDB Compounds: (A:) p-450-like protein

SCOPe Domain Sequences for d3zsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zsna_ a.104.1.0 (A:) automated matches {Micromonospora griseorubida [TaxId: 28040]}
epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtaapryavedvtlrgvtirag
epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
qrlpgirlgipetqlrwsegmllrgplelpvvw

SCOPe Domain Coordinates for d3zsna_:

Click to download the PDB-style file with coordinates for d3zsna_.
(The format of our PDB-style files is described here.)

Timeline for d3zsna_: