![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein automated matches [190135] (18 species) not a true protein |
![]() | Species Thermobifida fusca [TaxId:2021] [226300] (1 PDB entry) |
![]() | Domain d3zsea_: 3zse A: [218428] automated match to d1hixb_ complexed with edo |
PDB Entry: 3zse (more details), 1.78 Å
SCOPe Domain Sequences for d3zsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zsea_ b.29.1.11 (A:) automated matches {Thermobifida fusca [TaxId: 2021]} avtsnqtgyhdgyfysfwtdapgtvsmelgpggnystswrntgnfvagkgwatggrrtvt ysasfnpsgnayltlygwtrnplveyyiveswgtyrptgtymgtvttdggtydiykttry napsiegtrtfdqywsvrqskrtsgtitagnhfdawarhgmhlgthdymimategyqssg ssnvtlgt
Timeline for d3zsea_: