| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries) |
| Domain d3zrfk_: 3zrf K: [218426] Other proteins in same PDB: d3zrfa_, d3zrfc_, d3zrfd_, d3zrff_, d3zrfg_, d3zrfi_, d3zrfj_, d3zrfl_ automated match to d2c9wc_ |
PDB Entry: 3zrf (more details), 2.8 Å
SCOPe Domain Sequences for d3zrfk_:
Sequence, based on SEQRES records: (download)
>d3zrfk_ d.42.1.1 (K:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d3zrfk_ d.42.1.1 (K:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnss
teipefpiapeialellmaanfldc
Timeline for d3zrfk_: