Lineage for d3zrfi_ (3zrf I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768930Protein automated matches [193392] (1 species)
    not a true protein
  7. 2768931Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2768942Domain d3zrfi_: 3zrf I: [218424]
    Other proteins in same PDB: d3zrfa_, d3zrfb_, d3zrfd_, d3zrfe_, d3zrfg_, d3zrfh_, d3zrfj_, d3zrfk_
    automated match to d4awjf_

Details for d3zrfi_

PDB Entry: 3zrf (more details), 2.8 Å

PDB Description: pVHL54-213-EloB-EloC complex_apo
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor,

SCOPe Domain Sequences for d3zrfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrfi_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqeri

SCOPe Domain Coordinates for d3zrfi_:

Click to download the PDB-style file with coordinates for d3zrfi_.
(The format of our PDB-style files is described here.)

Timeline for d3zrfi_: