Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein automated matches [193392] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
Domain d3zrfi_: 3zrf I: [218424] Other proteins in same PDB: d3zrfa_, d3zrfb_, d3zrfd_, d3zrfe_, d3zrfg_, d3zrfh_, d3zrfj_, d3zrfk_ automated match to d4awjf_ |
PDB Entry: 3zrf (more details), 2.8 Å
SCOPe Domain Sequences for d3zrfi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zrfi_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqeri
Timeline for d3zrfi_: