Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d3zrfg_: 3zrf G: [218422] Other proteins in same PDB: d3zrfb_, d3zrfc_, d3zrfe_, d3zrff_, d3zrfh_, d3zrfi_, d3zrfk_, d3zrfl_ automated match to d1lm8b_ |
PDB Entry: 3zrf (more details), 2.8 Å
SCOPe Domain Sequences for d3zrfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zrfg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmkp
Timeline for d3zrfg_: