Lineage for d3zrfe_ (3zrf E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552434Protein Elongin C [54699] (3 species)
  7. 2552437Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. 2552566Domain d3zrfe_: 3zrf E: [218420]
    Other proteins in same PDB: d3zrfa_, d3zrfc_, d3zrfd_, d3zrff_, d3zrfg_, d3zrfi_, d3zrfj_, d3zrfl_
    automated match to d2c9wc_

Details for d3zrfe_

PDB Entry: 3zrf (more details), 2.8 Å

PDB Description: pVHL54-213-EloB-EloC complex_apo
PDB Compounds: (E:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d3zrfe_:

Sequence, based on SEQRES records: (download)

>d3zrfe_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d3zrfe_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d3zrfe_:

Click to download the PDB-style file with coordinates for d3zrfe_.
(The format of our PDB-style files is described here.)

Timeline for d3zrfe_: