Lineage for d1eo7a1 (1eo7 A:497-583)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) 
Domain d1eo7a1: 1eo7 A:497-583 [21842]
Other proteins in same PDB: d1eo7a2, d1eo7a3, d1eo7a4
Details for d1eo7a1
PDB Entry: 1eo7 (more details), 2.48 Å
PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltohexaose
SCOP Domain Sequences for d1eo7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo7a1 b.1.1.5 (A:497-583) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls
SCOP Domain Coordinates for d1eo7a1:
Click to download the PDB-style file with coordinates for d1eo7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eo7a1:
- d1eo7a1 first appeared (with stable ids) in SCOP 1.55
- d1eo7a1 appears in SCOP 1.59
- d1eo7a1 appears in SCOP 1.63
- d1eo7a1 appears in the current release, SCOPe 2.08
View in 3D
