Lineage for d3zrcj_ (3zrc J:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158246Protein Elongin B [54246] (2 species)
  7. 2158247Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2158337Domain d3zrcj_: 3zrc J: [218413]
    Other proteins in same PDB: d3zrcb_, d3zrcc_, d3zrce_, d3zrcf_, d3zrch_, d3zrci_, d3zrck_, d3zrcl_
    automated match to d1lm8b_
    complexed with l8b

Details for d3zrcj_

PDB Entry: 3zrc (more details), 2.9 Å

PDB Description: pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zrcj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrcj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d3zrcj_:

Click to download the PDB-style file with coordinates for d3zrcj_.
(The format of our PDB-style files is described here.)

Timeline for d3zrcj_: