Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein automated matches [193392] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries) |
Domain d3zrci_: 3zrc I: [218412] Other proteins in same PDB: d3zrca_, d3zrcb_, d3zrcd_, d3zrce_, d3zrcg_, d3zrch_, d3zrcj_, d3zrck_ automated match to d4awjf_ complexed with l8b |
PDB Entry: 3zrc (more details), 2.9 Å
SCOPe Domain Sequences for d3zrci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zrci_ b.3.3.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqeri
Timeline for d3zrci_: