Lineage for d3zrcg_ (3zrc G:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Elongin B [54246] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. Domain d3zrcg_: 3zrc G: [218410]
    Other proteins in same PDB: d3zrcb_, d3zrcc_, d3zrce_, d3zrcf_, d3zrch_, d3zrci_, d3zrck_, d3zrcl_
    automated match to d1lm8b_
    complexed with l8b

Details for d3zrcg_

PDB Entry: 3zrc (more details), 2.9 Å

PDB Description: pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zrcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrcg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqd

SCOPe Domain Coordinates for d3zrcg_ are not available.

Timeline for d3zrcg_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3zrca_, d3zrcb_, d3zrcc_, d3zrcd_, d3zrce_, d3zrcf_, d3zrch_, d3zrci_, d3zrcj_, d3zrck_, d3zrcl_