Lineage for d1cxf_1 (1cxf 496-581)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160677Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 160678Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 160706Domain d1cxf_1: 1cxf 496-581 [21841]
    Other proteins in same PDB: d1cxf_2, d1cxf_3, d1cxf_4

Details for d1cxf_1

PDB Entry: 1cxf (more details), 2.6 Å

PDB Description: complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin

SCOP Domain Sequences for d1cxf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxf_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1cxf_1:

Click to download the PDB-style file with coordinates for d1cxf_1.
(The format of our PDB-style files is described here.)

Timeline for d1cxf_1: