Lineage for d1cxf_1 (1cxf 496-581)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries) 
Domain d1cxf_1: 1cxf 496-581 [21841]
Other proteins in same PDB: d1cxf_2, d1cxf_3, d1cxf_4
Details for d1cxf_1
PDB Entry: 1cxf (more details), 2.6 Å
PDB Description: complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
SCOP Domain Sequences for d1cxf_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxf_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev
SCOP Domain Coordinates for d1cxf_1:
Click to download the PDB-style file with coordinates for d1cxf_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxf_1:
- d1cxf_1 appears in SCOP 1.57
- d1cxf_1 appears in the current release, SCOPe 2.08, called d1cxfa1
View in 3D
