Lineage for d3zrcf_ (3zrc F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768930Protein automated matches [193392] (1 species)
    not a true protein
  7. 2768931Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 2768953Domain d3zrcf_: 3zrc F: [218409]
    Other proteins in same PDB: d3zrca_, d3zrcb_, d3zrcd_, d3zrce_, d3zrcg_, d3zrch_, d3zrcj_, d3zrck_
    automated match to d4awjf_
    complexed with l8b

Details for d3zrcf_

PDB Entry: 3zrc (more details), 2.9 Å

PDB Description: pvhl54-213-elob-eloc complex (4r)-4-hydroxy-1-[(3-methylisoxazol-5-yl)acetyl]-n-[4-(1,3-oxazol-5-yl)benzyl]-l-prolinamide bound
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d3zrcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrcf_ b.3.3.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d3zrcf_:

Click to download the PDB-style file with coordinates for d3zrcf_.
(The format of our PDB-style files is described here.)

Timeline for d3zrcf_: