Lineage for d1dtua1 (1dtu A:497-583)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (27 PDB entries) 
Domain d1dtua1: 1dtu A:497-583 [21840]
Other proteins in same PDB: d1dtua2, d1dtua3, d1dtua4
Details for d1dtua1
PDB Entry: 1dtu (more details), 2.4 Å
PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase: a mutant y89d/s146p complexed to an hexasaccharide inhibitor
SCOP Domain Sequences for d1dtua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtua1 b.1.1.5 (A:497-583) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls
SCOP Domain Coordinates for d1dtua1:
Click to download the PDB-style file with coordinates for d1dtua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dtua1:
- d1dtua1 appears in SCOP 1.57
- d1dtua1 appears in the current release, SCOPe 2.08
View in 3D
