Lineage for d3zpyb_ (3zpy B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391101Species Zobellia galactanivorans [TaxId:63186] [224860] (7 PDB entries)
  8. 2391105Domain d3zpyb_: 3zpy B: [218398]
    automated match to d1uaia_
    complexed with na

Details for d3zpyb_

PDB Entry: 3zpy (more details), 1.43 Å

PDB Description: Crystal structure of the marine PL7 alginate lyase AlyA1 from Zobellia galactanivorans
PDB Compounds: (B:) alginate lyase, family pl7

SCOPe Domain Sequences for d3zpyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpyb_ b.29.1.0 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
nspasvlgitantwkinsfigspgssatyydditdasgisyntysddnyfytdgewvyfk
cyrglggsansqnprvelremdngnlaswtgdsgthtmewtvqvnqlpqdtdgdggvlcf
gqihgpsknsdgvevddvvrvqfigeenqssgsvklkisgyvteeqggsqtfsgysldtt
yncklvysggyvelfmngssvfrkkmevddlsenyfkvgnylqsvkgasytgsyglvrik
nlsvthn

SCOPe Domain Coordinates for d3zpyb_:

Click to download the PDB-style file with coordinates for d3zpyb_.
(The format of our PDB-style files is described here.)

Timeline for d3zpyb_: