SCOPe 2.06: Domain d3zpyb_: 3zpy B:

Lineage for d3zpyb_ (3zpy B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [224860] (6 PDB entries)

8. Domain d3zpyb_: 3zpy B: [218398]
   automated match to d1uaia_
   complexed with na

Details for d3zpyb_

PDB Entry: 3zpy, 1.43 Å

PDB Description: Crystal structure of the marine PL7 alginate lyase AlyA1 from Zobellia galactanivorans

PDB Compounds: (B:) alginate lyase, family pl7

SCOPe Domain Sequences for d3zpyb_:

Sequence; same for both SEQRES and ATOM records:

>d3zpyb_ b.29.1.0 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
nspasvlgitantwkinsfigspgssatyydditdasgisyntysddnyfytdgewvyfk
cyrglggsansqnprvelremdngnlaswtgdsgthtmewtvqvnqlpqdtdgdggvlcf
gqihgpsknsdgvevddvvrvqfigeenqssgsvklkisgyvteeqggsqtfsgysldtt
yncklvysggyvelfmngssvfrkkmevddlsenyfkvgnylqsvkgasytgsyglvrik
nlsvthn

Timeline for d3zpyb_:

• d3zpyb_ first appeared in SCOPe 2.03
  
• d3zpyb_ appears in SCOPe 2.05
  
• d3zpyb_ appears in SCOPe 2.07
  
• d3zpyb_ appears in the current release, SCOPe 2.08