Lineage for d3zpya_ (3zpy A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1309058Species Zobellia galactanivorans [TaxId:63186] [224860] (1 PDB entry)
  8. 1309059Domain d3zpya_: 3zpy A: [218397]
    automated match to d1uaia_
    complexed with na

Details for d3zpya_

PDB Entry: 3zpy (more details), 1.43 Å

PDB Description: Crystal structure of the marine PL7 alginate lyase AlyA1 from Zobellia galactanivorans
PDB Compounds: (A:) alginate lyase, family pl7

SCOPe Domain Sequences for d3zpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpya_ b.29.1.0 (A:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
gnspasvlgitantwkinsfigspgssatyydditdasgisyntysddnyfytdgewvyf
kcyrglggsansqnprvelremdngnlaswtgdsgthtmewtvqvnqlpqdtdgdggvlc
fgqihgpsknsdgvevddvvrvqfigeenqssgsvklkisgyvteeqggsqtfsgysldt
tyncklvysggyvelfmngssvfrkkmevddlsenyfkvgnylqsvkgasytgsyglvri
knlsvthn

SCOPe Domain Coordinates for d3zpya_:

Click to download the PDB-style file with coordinates for d3zpya_.
(The format of our PDB-style files is described here.)

Timeline for d3zpya_: