Lineage for d3zpga2 (3zpg A:151-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904034Species Acinetobacter baumannii [TaxId:470] [226628] (2 PDB entries)
  8. 2904035Domain d3zpga2: 3zpg A:151-357 [218396]
    Other proteins in same PDB: d3zpga1
    automated match to d2hxva1
    complexed with 5gp, act, cac, cl, oxl, so4, zn

Details for d3zpga2

PDB Entry: 3zpg (more details), 1.99 Å

PDB Description: acinetobacter baumannii ribd, form 2
PDB Compounds: (A:) ribd

SCOPe Domain Sequences for d3zpga2:

Sequence, based on SEQRES records: (download)

>d3zpga2 c.71.1.0 (A:151-357) automated matches {Acinetobacter baumannii [TaxId: 470]}
pyvrlkvassldgrtamasgeskwitgsaarqdvqhwraisgavitgidtviaddcqlnv
rslhnidietvaqpkrvildrrgrlpltakilenpetvmvmgpyrqeladlgviqleiqp
lktllqtlskqyqiydvlieagatlssaflqeglidemisyvaptllgqsaramfnadfe
ymaqqlrfklldviqldqdirlrlipt

Sequence, based on observed residues (ATOM records): (download)

>d3zpga2 c.71.1.0 (A:151-357) automated matches {Acinetobacter baumannii [TaxId: 470]}
pyvrlkvassldgrtamasgesitgsaarqdvqhwraisgavitgidtviaddcqlnvrs
lhnidietvaqpkrvildrrgrlpltakilenpetvmvmgpyrqeladlgviqleiqplk
tllqtlskqyqiydvlieagatlssaflqeglidemisyvaptllgqsaramfnadfeym
aqqlrfklldviqldqdirlrlipt

SCOPe Domain Coordinates for d3zpga2:

Click to download the PDB-style file with coordinates for d3zpga2.
(The format of our PDB-style files is described here.)

Timeline for d3zpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zpga1