| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (27 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [226628] (2 PDB entries) |
| Domain d3zpcb2: 3zpc B:151-358 [218394] Other proteins in same PDB: d3zpca1, d3zpcb1 automated match to d2hxva1 complexed with act, po4, zn |
PDB Entry: 3zpc (more details), 2.2 Å
SCOPe Domain Sequences for d3zpcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zpcb2 c.71.1.0 (B:151-358) automated matches {Acinetobacter baumannii [TaxId: 470]}
pyvrlkvassldgrtamasgeskwitgsaarqdvqhwraisgavitgidtviaddcqlnv
rslhnidietvaqpkrvildrrgrlpltakilenpetvmvmgpyrqeladlgviqleiqp
lktllqtlskqyqiydvlieagatlssaflqeglidemisyvaptllgqsaramfnadfe
ymaqqlrfklldviqldqdirlrliptq
Timeline for d3zpcb2: