Lineage for d1cgu_1 (1cgu 495-579)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223333Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
    follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases
  7. 223334Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 223358Domain d1cgu_1: 1cgu 495-579 [21838]
    Other proteins in same PDB: d1cgu_2, d1cgu_3, d1cgu_4
    complexed with ca, glc; mutant

Details for d1cgu_1

PDB Entry: 1cgu (more details), 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis

SCOP Domain Sequences for d1cgu_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgu_1 b.1.18.2 (495-579) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

SCOP Domain Coordinates for d1cgu_1:

Click to download the PDB-style file with coordinates for d1cgu_1.
(The format of our PDB-style files is described here.)

Timeline for d1cgu_1: