SCOP 1.61: Domain d1cgu_1: 1cgu 495-579

Lineage for d1cgu_1 (1cgu 495-579)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)

8. Domain d1cgu_1: 1cgu 495-579 [21838]
   Other proteins in same PDB: d1cgu_2, d1cgu_3, d1cgu_4

Details for d1cgu_1

PDB Entry: 1cgu, 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis

SCOP Domain Sequences for d1cgu_1:

Sequence; same for both SEQRES and ATOM records:

>d1cgu_1 b.1.1.5 (495-579) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

Timeline for d1cgu_1:

• d1cgu_1 first appeared (with stable ids) in SCOP 1.55
  
• d1cgu_1 appears in SCOP 1.59
  
• d1cgu_1 appears in SCOP 1.63
  
• d1cgu_1 appears in the current release, SCOPe 2.08, called d1cgua1