SCOP 1.69: Domain d2dij_1: 2dij 497-583

Lineage for d2dij_1 (2dij 497-583)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (17 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Bacillus circulans, different strains [TaxId:1397] [49216] (36 PDB entries)

8. Domain d2dij_1: 2dij 497-583 [21836]
   Other proteins in same PDB: d2dij_2, d2dij_3, d2dij_4

Details for d2dij_1

PDB Entry: 2dij, 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose

SCOP Domain Sequences for d2dij_1:

Sequence; same for both SEQRES and ATOM records:

>d2dij_1 b.1.18.2 (497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains}
atptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipav
aggnynikvanaagtasnvydnfevls

Timeline for d2dij_1:

• d2dij_1 first appeared (with stable ids) in SCOP 1.55
  
• d2dij_1 appears in SCOP 1.67
  
• d2dij_1 appears in SCOP 1.71
  
• d2dij_1 appears in the current release, SCOPe 2.08, called d2dija1