Lineage for d3znji_ (3znj I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907346Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 1907374Domain d3znji_: 3znj I: [218341]
    automated match to d3znua_
    complexed with cl, edo

Details for d3znji_

PDB Entry: 3znj (more details), 2.1 Å

PDB Description: Crystal structure of unliganded ClcF from R.opacus 1CP in crystal form 1.
PDB Compounds: (I:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d3znji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znji_ d.58.4.0 (I:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

SCOPe Domain Coordinates for d3znji_:

Click to download the PDB-style file with coordinates for d3znji_.
(The format of our PDB-style files is described here.)

Timeline for d3znji_: