SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3znjd_ (3znj D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173213Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2173214Protein automated matches [190081] (23 species)
    not a true protein
  7. 2173352Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 2173375Domain d3znjd_: 3znj D: [218336]
    automated match to d3znua_
    complexed with cl, edo

Details for d3znjd_

PDB Entry: 3znj (more details), 2.1 Å

PDB Description: Crystal structure of unliganded ClcF from R.opacus 1CP in crystal form 1.
PDB Compounds: (D:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d3znjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znjd_ d.58.4.0 (D:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

SCOPe Domain Coordinates for d3znjd_:

Click to download the PDB-style file with coordinates for d3znjd_.
(The format of our PDB-style files is described here.)

Timeline for d3znjd_: