Lineage for d3znj6_ (3znj 6:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950427Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 2950443Domain d3znj6_: 3znj 6: [218329]
    automated match to d3znua_
    complexed with cl, edo

Details for d3znj6_

PDB Entry: 3znj (more details), 2.1 Å

PDB Description: Crystal structure of unliganded ClcF from R.opacus 1CP in crystal form 1.
PDB Compounds: (6:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d3znj6_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znj6_ d.58.4.0 (6:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldpreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

SCOPe Domain Coordinates for d3znj6_:

Click to download the PDB-style file with coordinates for d3znj6_.
(The format of our PDB-style files is described here.)

Timeline for d3znj6_: