![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries) |
![]() | Domain d3znj4_: 3znj 4: [218327] automated match to d3znua_ complexed with cl, edo |
PDB Entry: 3znj (more details), 2.1 Å
SCOPe Domain Sequences for d3znj4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znj4_ d.58.4.0 (4:) automated matches {Rhodococcus opacus [TaxId: 37919]} mlylvrmtvnlprnldpreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns hdelheilwslpffpyltidveplshhparvgkd
Timeline for d3znj4_:
![]() Domains from other chains: (mouse over for more information) d3znj1_, d3znj2_, d3znj3_, d3znj5_, d3znj6_, d3znj7_, d3znj8_, d3znj9_, d3znja_, d3znjb_, d3znjc_, d3znjd_, d3znje_, d3znjf_, d3znjg_, d3znjh_, d3znji_, d3znjj_, d3znjk_, d3znjl_, d3znjm_, d3znjn_, d3znjo_, d3znjp_, d3znjr_, d3znjs_, d3znjt_, d3znju_, d3znjv_, d3znjw_, d3znjx_, d3znjy_, d3znjz_ |