Lineage for d1cgx_1 (1cgx 496-581)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160677Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 160678Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 160693Domain d1cgx_1: 1cgx 496-581 [21832]
    Other proteins in same PDB: d1cgx_2, d1cgx_3, d1cgx_4

Details for d1cgx_1

PDB Entry: 1cgx (more details), 2.59 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgx_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgx_1 b.1.1.5 (496-581) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
tatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgaditswedtqikvkipa
vaggnynikvanaagtasnvydnfev

SCOP Domain Coordinates for d1cgx_1:

Click to download the PDB-style file with coordinates for d1cgx_1.
(The format of our PDB-style files is described here.)

Timeline for d1cgx_1: