SCOPe 2.05: Domain d3zl2a_: 3zl2 A:

Lineage for d3zl2a_ (3zl2 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (2 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)

8. Domain d3zl2a_: 3zl2 A: [218312]
   automated match to d1uwfa_
   complexed with bwg

Details for d3zl2a_

PDB Entry: 3zl2, 1.25 Å

PDB Description: a thiazolyl-mannoside bound to fimh, orthorhombic space group

PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d3zl2a_:

Sequence; same for both SEQRES and ATOM records:

>d3zl2a_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d3zl2a_:

• d3zl2a_ first appeared in SCOPe 2.03
  
• d3zl2a_ appears in SCOPe 2.04
  
• d3zl2a_ appears in SCOPe 2.06
  
• d3zl2a_ appears in the current release, SCOPe 2.08