SCOPe 2.03: Domain d3zl1b_: 3zl1 B:

Lineage for d3zl1b_ (3zl1 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (21 PDB entries)

8. Domain d3zl1b_: 3zl1 B: [218311]
   automated match to d1uwfa_
   complexed with bwg, cl

Details for d3zl1b_

PDB Entry: 3zl1, 1.55 Å

PDB Description: a thiazolyl-mannoside bound to fimh, monoclinic space group

PDB Compounds: (B:) protein fimh

SCOPe Domain Sequences for d3zl1b_:

Sequence; same for both SEQRES and ATOM records:

>d3zl1b_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d3zl1b_:

• d3zl1b_ is new in SCOPe 2.03-stable
  
• d3zl1b_ appears in SCOPe 2.04
  
• d3zl1b_ appears in the current release, SCOPe 2.08