Lineage for d8cgta1 (8cgt A:495-579)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105015Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 105016Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries)
  8. 105027Domain d8cgta1: 8cgt A:495-579 [21831]
    Other proteins in same PDB: d8cgta2, d8cgta3, d8cgta4

Details for d8cgta1

PDB Entry: 8cgt (more details), 2.4 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose

SCOP Domain Sequences for d8cgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cgta1 b.1.1.5 (A:495-579) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti

SCOP Domain Coordinates for d8cgta1:

Click to download the PDB-style file with coordinates for d8cgta1.
(The format of our PDB-style files is described here.)

Timeline for d8cgta1: