Lineage for d3zkya_ (3zky A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1807788Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 1807816Protein Isopenicillin N synthase [51199] (1 species)
  7. 1807817Species Emericella nidulans [TaxId:162425] [51200] (26 PDB entries)
    Uniprot P05326
  8. 1807830Domain d3zkya_: 3zky A: [218309]
    automated match to d1odma_
    complexed with fe, gol, so4, wt4

Details for d3zkya_

PDB Entry: 3zky (more details), 1.45 Å

PDB Description: isopenicillin n synthase with substrate analogue ahcmc
PDB Compounds: (A:) isopenicillin n synthase

SCOPe Domain Sequences for d3zkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkya_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOPe Domain Coordinates for d3zkya_:

Click to download the PDB-style file with coordinates for d3zkya_.
(The format of our PDB-style files is described here.)

Timeline for d3zkya_: