SCOPe 2.08: Domain d3zksd1: 3zks D:165-271

Lineage for d3zksd1 (3zks D:165-271)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d3zksd1: 3zks D:165-271 [218307]
   Other proteins in same PDB: d3zksa_, d3zksd2
   automated match to d3ezjb_
   complexed with wzv

Details for d3zksd1

PDB Entry: 3zks, 2.11 Å

PDB Description: bace2 xaperone complex with inhibitor

PDB Compounds: (D:) xa4813

SCOPe Domain Sequences for d3zksd1:

Sequence; same for both SEQRES and ATOM records:

>d3zksd1 b.1.1.1 (D:165-271) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss

Timeline for d3zksd1:

• d3zksd1 first appeared in SCOPe 2.03, called d3zksd_
  
• d3zksd1 appears in SCOPe 2.07