Lineage for d3zkqd1 (3zkq D:165-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743690Domain d3zkqd1: 3zkq D:165-273 [218305]
    Other proteins in same PDB: d3zkqa_, d3zkqd2
    automated match to d3ezjb_
    complexed with b3p, cl

Details for d3zkqd1

PDB Entry: 3zkq (more details), 1.51 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (D:) xa4813

SCOPe Domain Sequences for d3zkqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkqd1 b.1.1.1 (D:165-273) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsittyadsvk
grftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshh

SCOPe Domain Coordinates for d3zkqd1:

Click to download the PDB-style file with coordinates for d3zkqd1.
(The format of our PDB-style files is described here.)

Timeline for d3zkqd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zkqd2
View in 3D
Domains from other chains:
(mouse over for more information)
d3zkqa_