Lineage for d3zkqa_ (3zkq A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061062Species Human (Homo sapiens) [TaxId:9606] [193159] (12 PDB entries)
  8. 2061063Domain d3zkqa_: 3zkq A: [218304]
    Other proteins in same PDB: d3zkqd_
    automated match to d4belb_
    complexed with b3p, cl

Details for d3zkqa_

PDB Entry: 3zkq (more details), 1.51 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (A:) Beta-secretase 2

SCOPe Domain Sequences for d3zkqa_:

Sequence, based on SEQRES records: (download)

>d3zkqa_ b.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
vfdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
eiagaavseisgpfstedvasncvpa

Sequence, based on observed residues (ATOM records): (download)

>d3zkqa_ b.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
gilglayatlakpsssletffdslvtqanipnvfsmqmcgagggslvlggiepslykgdi
wytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveav
araslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqp
mmaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavsei
sgpfstedvasncvpa

SCOPe Domain Coordinates for d3zkqa_:

Click to download the PDB-style file with coordinates for d3zkqa_.
(The format of our PDB-style files is described here.)

Timeline for d3zkqa_: