Lineage for d3zkpa_ (3zkp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005867Species Saccharopolyspora erythraea [TaxId:405948] [226655] (1 PDB entry)
  8. 2005868Domain d3zkpa_: 3zkp A: [218303]
    automated match to d1z8oa_
    complexed with erb, hem; mutant

Details for d3zkpa_

PDB Entry: 3zkp (more details), 2 Å

PDB Description: Structure of a mutant of P450 EryK in complex with erythromycin B.
PDB Compounds: (A:) erythromycin c-12 hydroxylase

SCOPe Domain Sequences for d3zkpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkpa_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 405948]}
vpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrviega
sptpgaiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvdvla
fplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltaylkar
caerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtldeh
pahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvlsan
rdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrltvd
rdderlrhfeqivlgtrhlpvlagssprqsa

SCOPe Domain Coordinates for d3zkpa_:

Click to download the PDB-style file with coordinates for d3zkpa_.
(The format of our PDB-style files is described here.)

Timeline for d3zkpa_: