![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Saccharopolyspora erythraea [TaxId:405948] [226655] (1 PDB entry) |
![]() | Domain d3zkpa_: 3zkp A: [218303] automated match to d1z8oa_ complexed with erb, hem; mutant |
PDB Entry: 3zkp (more details), 2 Å
SCOPe Domain Sequences for d3zkpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zkpa_ a.104.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 405948]} vpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrviega sptpgaiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvdvla fplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltaylkar caerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtldeh pahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvlsan rdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrltvd rdderlrhfeqivlgtrhlpvlagssprqsa
Timeline for d3zkpa_: