Lineage for d3zkml2 (3zkm L:112-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752579Domain d3zkml2: 3zkm L:112-217 [218302]
    Other proteins in same PDB: d3zkma_, d3zkmb_, d3zkmc_, d3zkmd1, d3zkmh_, d3zkml1
    automated match to d1dqdl2
    complexed with dms, gol, so4

Details for d3zkml2

PDB Entry: 3zkm (more details), 1.85 Å

PDB Description: bace2 fab complex
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3zkml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zkml2 b.1.1.2 (L:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3zkml2:

Click to download the PDB-style file with coordinates for d3zkml2.
(The format of our PDB-style files is described here.)

Timeline for d3zkml2: