Lineage for d3zkib_ (3zki B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393838Species Human (Homo sapiens) [TaxId:9606] [193159] (12 PDB entries)
  8. 2393855Domain d3zkib_: 3zki B: [218296]
    automated match to d3zlqb_
    complexed with wzv; mutant

Details for d3zkib_

PDB Entry: 3zki (more details), 2.4 Å

PDB Description: bace2 mutant structure with ligand
PDB Compounds: (B:) Beta-secretase 2

SCOPe Domain Sequences for d3zkib_:

Sequence, based on SEQRES records: (download)

>d3zkib_ b.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
glayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggieps
lykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfd
avveavaraslipafsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilp
qlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeia
gaavseisgpfstedvasncvp

Sequence, based on observed residues (ATOM records): (download)

>d3zkib_ b.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
glayatlakpsssletffdslvtqanipnvfsmqmcganggslvlggiepslykgdiwyt
pikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavara
ssdgfwtgsqlacwttpwsyfpkisiylrdenssrsfritilpqlyiqpmmgyecyrfgi
spstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfstedvasncv
p

SCOPe Domain Coordinates for d3zkib_:

Click to download the PDB-style file with coordinates for d3zkib_.
(The format of our PDB-style files is described here.)

Timeline for d3zkib_: