Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
Protein Enterochelin uptake protein CeuE [142792] (1 species) |
Species Campylobacter jejuni [TaxId:197] [142793] (3 PDB entries) Uniprot Q0P8Q4 44-330 |
Domain d3zk3a_: 3zk3 A: [218294] automated match to d3zkwa_ complexed with fe, lcm |
PDB Entry: 3zk3 (more details), 1.89 Å
SCOPe Domain Sequences for d3zk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zk3a_ c.92.2.4 (A:) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]} lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq srfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgil dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
Timeline for d3zk3a_: