Lineage for d3zina_ (3zin A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725423Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 2725546Protein automated matches [190070] (4 species)
    not a true protein
  7. 2725579Species Mouse (Mus musculus) [TaxId:10090] [186790] (4 PDB entries)
  8. 2725581Domain d3zina_: 3zin A: [218293]
    automated match to d1q1sc_

Details for d3zina_

PDB Entry: 3zin (more details), 2 Å

PDB Description: Gu_alpha_helicase
PDB Compounds: (A:) Importin subunit alpha-2

SCOPe Domain Sequences for d3zina_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zina_ a.118.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyfs

SCOPe Domain Coordinates for d3zina_:

Click to download the PDB-style file with coordinates for d3zina_.
(The format of our PDB-style files is described here.)

Timeline for d3zina_: